The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the Gly_acyl_tr_N domain shown below is 1.2e-71.

MFCLQSSQALQVLENSLRKHLPESLKGNPFKLKTLVDKWPDFNTVVIRPQEEDMTDDLDH
YNNTYLVYSKDPKHCQEFLGSSEVINWKQHLQIQSSQSDLGKVIESLGATNLGKVKHKQC
FLYMVCQTAKKLAPSLMDAKNLVVSRNKLTPLFCIM

Gly_acyl_tr_N

Gly_acyl_tr_N
PFAM accession number:PF06021
Interpro abstract (IPR015938):

This entry represents glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; EC 2.3.1.13 ). Mitochondrial acyltransferases catalyse the transfer of an acyl group from acyl-CoA to the N terminus of glycine to produce N-acylglycine. These enzymes can conjugate a multitude of substrates to form a variety of N-acylglycines. The CoA derivatives of a number of aliphatic and aromatic acids, but not phenylacetyl-CoA or (indol-3-yl)acetyl-CoA, can act as donor [ (PUBMED:10630424) (PUBMED:8660675) ].

GO component:mitochondrion (GO:0005739)
GO function:glycine N-acyltransferase activity (GO:0047961)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gly_acyl_tr_N