The domain within your query sequence starts at position 31 and ends at position 229; the E-value for the Glyco_hydro_20 domain shown below is 1.7e-18.
PLFHALGANGLLIEYEDMFPYEGHLRLLRAKHAYSPSEVTEILRLARLSELEVIPLVQTF GHMEFVLKHAAFAHLREVALFPNTLNPHEAESLALVQAMIDQILELHRDVRWLHIGCDEV YYLGEGETSKQWLQQEQNSHAKLCLSHMQAVASHVLTQHPGVTPLVWDDMLRDIPQEQLK ASGVPQLVEPVLWDYGADL
Glyco_hydro_20 |
![]() |
---|
PFAM accession number: | PF00728 |
---|---|
Interpro abstract (IPR015883): | Glycoside hydrolase family 20 comprises enzymes with several known activities; beta-hexosaminidase ( EC 3.2.1.52 ); lacto-N-biosidase ( EC 3.2.1.140 ); beta-1,6-N-acetylglucosaminidase); and beta-6-SO3-N-acetylglucosaminidase. Carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic nucleophile/base in this family of enzymes. This entry represents the glycoside hydrolase family 20 catalytic domain. This domain has a TIM barrel fold. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_20