The domain within your query sequence starts at position 2 and ends at position 170; the E-value for the Glyco_hydro_31 domain shown below is 1.4e-53.
LFQTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTKRQDPVSWNKTFEDISRSV LETRYTLLPYLYTLMYKAHMEGSTVVRPLLHEFVSDRKTWNIDKQFLLGPAFLVSPVLEP NARNISAYFPTALWYDYYTGANINSTGEWKTLPAPLEHINLHVRGGYIL
Glyco_hydro_31 |
---|
PFAM accession number: | PF01055 |
---|---|
Interpro abstract (IPR000322): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Glycoside hydrolase family 31 comprises enzymes with several known activities; alpha-glucosidase ( EC 3.2.1.20 ), alpha-galactosidase ( EC 3.2.1.22 ); glucoamylase ( EC 3.2.1.3 ), sucrase-isomaltase ( EC 3.2.1.48 ); isomaltase ( EC 3.2.1.10 ); alpha-xylosidase ( EC 3.2.1 ); alpha-glucan lyase ( EC 4.2.2.13 ). Glycoside hydrolase family 31 groups a number of glycosyl hydrolases on the basis of sequence similarities [ (PUBMED:1747104) (PUBMED:1761061) (PUBMED:1743281) ]. An aspartic acid has been implicated [ (PUBMED:1856189) ] in the catalytic activity of sucrase, isomaltase, and lysosomal alpha-glucosidase. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_31