The domain within your query sequence starts at position 2 and ends at position 86; the E-value for the Glyco_hydro_38C domain shown below is 4.2e-8.

ETPVHGPHNPWPVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHPEKPQANLQRVLLR
LRHLYEAGEDPVLSRPATVDLKVNS

Glyco_hydro_38C

Glyco_hydro_38C
PFAM accession number:PF07748
Interpro abstract (IPR011682):

O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website.

Glycoside hydrolase family 38 comprises enzymes with only one known activity; alpha-mannosidase ( EC 3.2.1.24 ) ( EC 3.2.1.114 ). This domain is found at the C terminus of glycosyl hydrolases from family 38.

GO process:mannose metabolic process (GO:0006013)
GO function:alpha-mannosidase activity (GO:0004559)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_38C