The domain within your query sequence starts at position 352 and ends at position 449; the E-value for the Glyco_tran_28_C domain shown below is 5.3e-8.

TRVYKWLPQNDLLGHPKTKAFVTHGGANGVYEAIYHGIPMIGIPLFGEQHDNIAHMVAKG
AAVALNIRTMSKSDVLNALEEVIENPFYKKNAMWLSTI

Glyco_tran_28_C

Glyco_tran_28_C
PFAM accession number:PF04101
Interpro abstract (IPR007235):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

Glycosyltransferase family 28 comprises enzymes with a number of known activities; 1,2-diacylglycerol 3-beta-galactosyltransferase ( EC 2.4.1.46 ); 1,2-diacylglycerol 3-beta-glucosyltransferase ( EC 2.4.1.157 ); beta-N-acetylglucosamine transferase ( EC 2.4.1 ). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

GO function:transferase activity, transferring hexosyl groups (GO:0016758)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_tran_28_C