The domain within your query sequence starts at position 55 and ends at position 362; the E-value for the Glyco_transf_11 domain shown below is 1.6e-146.

VVSTIFHCHRRLSLVPGPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALA
RMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGQYVR
FTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYV
RVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNG
LQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAY
LPEWVGIA

Glyco_transf_11

Glyco_transf_11
PFAM accession number:PF01531
Interpro abstract (IPR002516):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

Glycosyltransferase family 11 comprises enzymes with only one known activity; galactoside 2-L-fucosyltransferase ( EC 2.4.1.69 ).

Some of the proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Galactoside 2-L-fucosyltransferase 1 ( EC 2.4.1.69 ) and Galactoside 2-L-fucosyltransferase 2 ( EC 2.4.1.69 ) belong to the Hh blood group system and are associated with H/h and Se/se antigens.

GO process:carbohydrate metabolic process (GO:0005975)
GO component:membrane (GO:0016020)
GO function:galactoside 2-alpha-L-fucosyltransferase activity (GO:0008107)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_11