The domain within your query sequence starts at position 74 and ends at position 404; the E-value for the Glyco_transf_6 domain shown below is 4.3e-182.
KIPEVGENRWQKDWWFPSWFKNGTHSYQEDNVEGRREKGRNGDRIEEPQLWDWFNPKNRP DVLTVTPWKAPIVWEGTYDTALLEKYYATQKLTVGLTVFAVGKYIEHYLEDFLESADMYF MVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHIQ HEVDFLFCMDVDQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGEG DFYYHAAIFGGTPTHILNLTRECFKGILQDKKHDIEAQWHDESHLNKYFLFNKPTKILSP EYCWDYQIGLPSDIKSVKVAWQTKEYNLVRN
Glyco_transf_6 |
![]() |
---|
PFAM accession number: | PF03414 |
---|---|
Interpro abstract (IPR005076): | The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'. Glycosyltransferase family 6 comprises enzymes with three known activities; alpha-1,3-galactosyltransferase ( EC 2.4.1.151 ); alpha-1,3 N-acetylgalactosaminyltransferase ( EC 2.4.1.40 ); alpha-galactosyltransferase ( EC 2.4.1.37 ). |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO component: | membrane (GO:0016020) |
GO function: | transferase activity, transferring hexosyl groups (GO:0016758) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_6