The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the Glyco_transf_64 domain shown below is 5.7e-40.
XHEMNKWKYESEWTNEVSMVLTGAAFYHKYFNYLYTYKMPGDIKNWVDTHMNCEDIAMNF LVANVTGKAVIKVTPRKKFKCPECTAIDGLSLDQTHMVER
Glyco_transf_64 |
![]() |
---|
PFAM accession number: | PF09258 |
---|---|
Interpro abstract (IPR015338): | Members of this family catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analog of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate [ (PUBMED:12562774) ]. |
GO component: | integral component of membrane (GO:0016021) |
GO function: | transferase activity, transferring glycosyl groups (GO:0016757) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_64