The domain within your query sequence starts at position 143 and ends at position 397; the E-value for the GpcrRhopsn4 domain shown below is 4.3e-81.
GLQLEYEMVLTNGKSFWTRHFSADEFGILETDVTFLLIFTLIFVLSCYFGYLLKGRQLLH TTYKMFMAAAGVEVLSLLFFCIYWGQYATDGIGNGSVKILAKLLFSSSFLIFLLTLILLG KGFTVTRGRISHSGSVKLSVYMTLYTLTHVVLLIYEAEFFDPGQVLYTYESPAGYGLIGL QVAAYVWFCYAVLVSLRHYPEKQPFYVPFFAAYTLWFFAVPVMALIANFGIPKWAREKIV NGIQLGIHLYAHGVF
GpcrRhopsn4 |
![]() |
---|
PFAM accession number: | PF10192 |
---|---|
Interpro abstract (IPR019336): | This entry represents a novel protein with seven transmembrane alpha-helical domains, termed it ITR (intimal thickness-related receptor). The ITR sequence contains a motif common to the Rhodopsin-like GPCR (G protein-coupled receptor) superfamily. In vivo analyses of this gene revealed that expression of ITR protein increased with intimal thickening induced by cuff placement around murine femoral artery. Furthermore, ITR-knockout mice were found to be resistant to this experimental intimal thickening [ (PUBMED:12538434) ]. |
GO process: | G protein-coupled receptor signaling pathway (GO:0007186), response to pheromone (GO:0019236) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GpcrRhopsn4