The domain within your query sequence starts at position 21 and ends at position 134; the E-value for the Gpi16 domain shown below is 2.7e-28.
RGCCGCAEGPRDSLREELVITPLPSGDVAATFQFRTRWDSDLQREGVSHYRLFPKALGQL ISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDYLHQYACT
Gpi16 |
 |
|---|
| PFAM accession number: | PF04113 |
|---|---|
| Interpro abstract (IPR007245): | Phosphatidylinositol-glycan biosynthesis class T protein (PIG-T, also known as Gpi16 in budding yeasts) is a component of the glycosylphosphatidylinositol (GPI) trans-amidase complex that adds GPIs to newly synthesized proteins [ (PUBMED:11598210) ]. Mammalian GPI transamidase consists of at least five components: Gaa1, Gpi8, PIG-S, PIG-T, and PIG-U, all five of which are required for its function. It is possible that Gaa1, Gpi8, PIG-S, and PIG-T form a tightly associated core that is only weakly associated with PIG-U. The exact function of PIG-S is unclear [ (PUBMED:14660601) ]. |
| GO process: | attachment of GPI anchor to protein (GO:0016255) |
| GO component: | GPI-anchor transamidase complex (GO:0042765) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gpi16