The domain within your query sequence starts at position 20 and ends at position 106; the E-value for the Guanylin domain shown below is 9e-38.
QGVYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQE AASTFKALRTIATDECELCINVACTGC
Guanylin |
 |
|---|
| PFAM accession number: | PF02058 |
|---|---|
| Interpro abstract (IPR000879): | This entry represents the guanylin family. Its members include guanylate cyclase activator 2A and 2B. They are endogenous activators of intestinal guanylate cyclases. Guanylin, a 15-amino-acid peptide, is an endogenous ligand of the intestinal receptor guanylate cyclase-C, known as STaR [ (PUBMED:7713512) (PUBMED:1409606) ]. Upon receptor binding, guanylin increases the intracellular concentration of cGMP, it induces chloride secretion and decreases intestinal fluid absorption, ultimately causing diarrhoea [ (PUBMED:1346555) ]. The peptide stimulates the enzyme through the same receptor binding region as the heat-stable enterotoxins [ (PUBMED:1409606) ]. |
| GO component: | extracellular region (GO:0005576) |
| GO function: | guanylate cyclase activator activity (GO:0030250) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Guanylin