The domain within your query sequence starts at position 16 and ends at position 80; the E-value for the HATPase_c domain shown below is 5.3e-13.

QTITSVVSVVKELIENSLDAGATSIEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYT
SKISS

HATPase_c

HATPase_c
PFAM accession number:PF02518
Interpro abstract (IPR003594):

This domain is found in several ATP-binding proteins, including: histidine kinase [ (PUBMED:15157101) ], DNA gyrase B, topoisomerases [ (PUBMED:15105144) ], heat shock protein HSP90 [ (PUBMED:15292259) (PUBMED:14718169) (PUBMED:15217611) ], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HATPase_c