The domain within your query sequence starts at position 33 and ends at position 125; the E-value for the HBS1_N domain shown below is 1e-22.
SPSTAAQFIYSRRDNPEEEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAV PDDILTEAILKHKFDVQKALSVVLEQDGVQPWK
HBS1_N |
 |
|---|
| PFAM accession number: | PF08938 |
|---|---|
| Interpro abstract (IPR015033): | This domain is found at the N terminus of HBS1 proteins. It interacts with the ribosomal protein rpS3 at the mRNA entry site [ (PUBMED:21623367) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HBS1_N