The domain within your query sequence starts at position 1610 and ends at position 1640; the E-value for the HEAT domain shown below is 2.2e-5.
LIVALQLLLKDPVPGVREKAAETLGRLVKFA
HEAT |
![]() |
---|
PFAM accession number: | PF02985 |
---|---|
Interpro abstract (IPR000357): | The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [ (PUBMED:7550332) ]. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes. In the crystal structure of PP2A PR65/A [ (PUBMED:9989501) ], the HEAT repeats consist of pairs of antiparallel alpha helices [ (PUBMED:7550332) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HEAT