The domain within your query sequence starts at position 65 and ends at position 184; the E-value for the HECW_N domain shown below is 6.5e-62.
RSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIGEVSSEN FLDYKNRGVNGSHRGQIIWKIDASSYFVESETKICFKYYHGVSGALRATTPSVTVKNSAA
HECW_N |
![]() |
---|
PFAM accession number: | PF16562 |
---|---|
Interpro abstract (IPR032348): | This entry represents a domain found in E3 ubiquitin-protein ligases HECW1 and HECW2 that lies upstream of the C2 domain. Its function is not clearly understood, but it might be to determine the substrate spectrum of the ligase [ (PUBMED:23545411) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HECW_N