The domain within your query sequence starts at position 1329 and ends at position 1402; the E-value for the HELP domain shown below is 5e-15.
EVSMEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDGAD IIFHTAAAGIVQNL
HELP |
 |
|---|
| PFAM accession number: | PF03451 |
|---|---|
| Interpro abstract (IPR005108): | The HELP (Hydrophobic ELP) domain is found in EMAP and EMAP-like proteins (ELPs) [ (PUBMED:11694528) (PUBMED:7989351) ]. Although called a domain it contains a predicted transmembrane helix and may not form a globular domain. It is also not clear if these proteins localize to membranes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HELP