The domain within your query sequence starts at position 101 and ends at position 174; the E-value for the HEXIM domain shown below is 2.3e-23.
WRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPLAPYNTTQFLMNDRDLEEPNLDVL HGPSHSGSGGENEA
HEXIM |
![]() |
---|
PFAM accession number: | PF15313 |
---|---|
Interpro abstract (IPR024872): | Hexamethylene bisacetamide-inducible proteins (HEXIMs) are transcriptional regulators that function as general RNA polymerase II transcription inhibitors. HEXIMs, aided by the 7SK snRNA, sequester positive transcriptional elongation factor b (P-TEFb) into a large inactive 7SK snRNP complex [ (PUBMED:14580347) (PUBMED:15713661) ]. This prevents P-TEFb from phosphorylating RNA polymerase II and blocks subsequent transcriptional elongation. Two HEXIM family members have been identified in mammals, termed HEXIM1 and HEXIM2, which exhibit distinct expression patterns [ (PUBMED:15713661) ]. |
GO process: | negative regulation of transcription by RNA polymerase II (GO:0000122) |
GO component: | cytoplasm (GO:0005737), nucleus (GO:0005634) |
GO function: | snRNA binding (GO:0017069), cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HEXIM