The domain within your query sequence starts at position 410 and ends at position 501; the E-value for the HGTP_anticodon domain shown below is 1.8e-16.

QVFVATPQKNFLQERLKIIAELWDAGIKAEMLYKNNPKLLTQLHYCEKADIPLMVIIGEQ
ERNEGVIKLRSVASREEVTINRESLVAEIQKR

HGTP_anticodon

HGTP_anticodon
PFAM accession number:PF03129
Interpro abstract (IPR004154):

tRNA synthetases, or tRNA ligases are involved in protein synthesis. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases [ (PUBMED:10447505) ]. It is probably the anticodon binding domain [ (PUBMED:9115984) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HGTP_anticodon