The domain within your query sequence starts at position 668 and ends at position 764; the E-value for the HHH_7 domain shown below is 1.6e-6.
DPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLNANRAKNI IEWREKNGPFINREQLKKVKGLGPKSFQQCAGFVRIN
HHH_7 |
---|
PFAM accession number: | PF14635 |
---|---|
Interpro abstract (IPR032706): | This entry represents a helix-hairpin-helix motif found in the transcription elongation factor Spt6 [ (PUBMED:21094070) ]. Spt6 is involved in the regulation of histone modification [ (PUBMED:24107707) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HHH_7