The domain within your query sequence starts at position 25 and ends at position 79; the E-value for the HIG_1_N domain shown below is 1.5e-22.
TRESPLVPIGVAGCLVIAAYRIYRLKARGSTKLSIHLIHTRVAAQACAVGAIMLG
HIG_1_N |
![]() |
---|
PFAM accession number: | PF04588 |
---|---|
Interpro abstract (IPR007667): | This domain is found in proteins thought to be involved in the response to hypoxia [ (PUBMED:11172064) ]. It is also found in altered inheritance of mitochondria proteins. The hypoxia induced gene 1 (HIG1) or hypoglycemia/hypoxia inducible mitochondrial protein (HIMP1) is up-regulated by stresses of the microenvironment such as low oxygen or low glucose conditions. HIG1 is a mitochondrial inner membrane protein, which is ubiquitously expressed. It is predicted to be an integral membrane protein consisting of two hydrophobic helices, 21-23 residues in length that might tend to form a hairpin-like loop across the bilayer. HIG1 could be implied in apoptotic or cytoprotective signals. HIG1 is a member of a well conserved eukaryote protein family. The predicted transmembrane helice (TMH) and loop regions represent the most highly conserved regions in these proteins [ (PUBMED:15968589) (PUBMED:16815968) ]. The profile we developed covers the predicted TMH and loop regions. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HIG_1_N