The domain within your query sequence starts at position 90 and ends at position 153; the E-value for the HJURP_C domain shown below is 3.7e-8.
KKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSP NALS
HJURP_C |
 |
|---|
| PFAM accession number: | PF12347 |
|---|---|
| Interpro abstract (IPR022102): | Although this family is conserved in the Holliday junction regulator, HJURP, proteins in higher eukaryotes, alongside an Scm3, family, its exact function is not known. The C-terminal region of Scm3 proteins has been evolving rapidly, and this short repeat at the C-terminal end can be present in up to two copies in the higher eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HJURP_C