The domain within your query sequence starts at position 254 and ends at position 370; the E-value for the HJURP_mid domain shown below is 7.6e-54.

MSRLLRSKPSCIISTKTYINQSWKLRRRPSRKQGLHKNRTHCPRSKPSQRSARKGPASCS
EPGKEAGILRDYGNLLHVAPHKTGLELKSVSLEGSKRQVHKSSPAWKELQMMPQKDL

HJURP_mid

HJURP_mid
PFAM accession number:PF12346
Interpro abstract (IPR021052):

Vertebral Holliday junction recognition proteins carry an SCM3 domain at their N terminus as do the eukaryotic fungi, but they also carry this central, conserved region. Further downstream there is also a repeated domain, also of unknown function. Investigation of Scm3 and associated proteins is likely to be directly relevant to understanding the mechanism of HJURP-mediated CENP-A chromatin assembly at human centromeres [ (PUBMED:19410544) (PUBMED:19410545) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HJURP_mid