The domain within your query sequence starts at position 636 and ends at position 789; the E-value for the HMMR_C domain shown below is 4.3e-71.

RKQLEEKGKRTAEKENVMTELTMEINKWRLLYEELYEKTKPFQQQLDAFEAEKQALLNEH
GATQEQLNKIRDSYAQLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELR
LQGELDKALGIRHFDPSKAFCHASKENFTPLKEG

HMMR_C

• PFAM accession number: PF15908
• Interpro abstract (IPR031794):

  This domain corresponds to the C-terminal region of eukaryotic hyaluronan-mediated motility receptor protein (RHAMM), and may be involved in centrosome targeting [ (PUBMED:12808028) ]. This domain is also found C-terminal in kinesin-like protein KIF15 [ (PUBMED:24419385) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HMMR_C