The domain within your query sequence starts at position 1 and ends at position 176; the E-value for the HNF-1_N domain shown below is 4e-86.

MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLMVGEGPLDKGESCGGSRGDLTEL
PNGLGETRGSEDDTDDDGEDFAPPILKELENLSPEEAAHQKAVVESLLQEDPWRVAKMVK
SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQ

HNF-1_N

HNF-1_N
PFAM accession number:PF04814
Interpro abstract (IPR006899):

This domain consists of the N terminus of homeobox-containing transcription factor HNF-1. This region contains a dimerisation sequence [ (PUBMED:1988016) ] and an acidic region that may be involved in transcription activation. Mutations and the common Ala/Val 98 polymorphism in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3) [ (PUBMED:9133564) ].

GO process:positive regulation of transcription, DNA-templated (GO:0045893)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF-1_N