The domain within your query sequence starts at position 1 and ends at position 176; the E-value for the HNF-1_N domain shown below is 4e-86.
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLMVGEGPLDKGESCGGSRGDLTEL PNGLGETRGSEDDTDDDGEDFAPPILKELENLSPEEAAHQKAVVESLLQEDPWRVAKMVK SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQ
HNF-1_N |
---|
PFAM accession number: | PF04814 |
---|---|
Interpro abstract (IPR006899): | This domain consists of the N terminus of homeobox-containing transcription factor HNF-1. This region contains a dimerisation sequence [ (PUBMED:1988016) ] and an acidic region that may be involved in transcription activation. Mutations and the common Ala/Val 98 polymorphism in HNF-1 cause the type 3 form of maturity-onset diabetes of the young (MODY3) [ (PUBMED:9133564) ]. |
GO process: | positive regulation of transcription, DNA-templated (GO:0045893) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNF-1_N