The domain within your query sequence starts at position 83 and ends at position 244; the E-value for the HNOB domain shown below is 6e-60.
YGFINTCLQSLVTEKFGEETWEKLKASAEVQDVFMTYTVYDDTITVKLIQEACKALDVSM EAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVE GGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSI
HNOB |
![]() |
---|
PFAM accession number: | PF07700 |
---|---|
Interpro abstract (IPR011644): | The HNOB (Haem NO Binding) domain is a predominantly alpha-helical domain and binds heme via a covalent linkage to histidine [ (PUBMED:12590654) ]. This domain is found in soluble guanylate cyclases, which are nitric oxide-responsive signaling proteins. It is predicted to function as a haem-dependent sensor for gaseous ligands and to transduce diverse downstream signals in both bacteria and animals. In Clostridium botulinum displays femtomolar affinity for nitrous oxide (NO) [ (PUBMED:15472039) ]. |
GO function: | heme binding (GO:0020037) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HNOB