SMART: Pfam domain HSA

The domain within your query sequence starts at position 108 and ends at position 177; the E-value for the HSA domain shown below is 1.1e-22.

VPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKEERARRE
EQAKLRRIAS

HSA

PFAM accession number:	PF07529
Interpro abstract (IPR014012):	The helicase/SANT-associated (HSA) domain is a predicted DNA-binding domain of ~75 amino acids [ (PUBMED:11779830) ], which is found in the eukaryotic SRCAP/p400/DOM and SNF2/brahma families [ (PUBMED:16024792) ]. While each family has the core sequences that define the HSA domain, they each also have additional sequences that distinguish these families from one another. For example, the sequence HWDY(L/C)EEEM(Q/V) is found in the SRCAP/p400/DOM family, whereas the sequence HQE(Y/F)LNSILQ is found in the SNF2 /brahma family [ (PUBMED:16024792) ]. In addition to the SANT and helicase domains, the HSA domain is also found in association with the bromo domain [ (PUBMED:11779830) ].

PFAM accession number:

PF07529

Interpro abstract (IPR014012):

The helicase/SANT-associated (HSA) domain is a predicted DNA-binding domain of ~75 amino acids [ (PUBMED:11779830) ], which is found in the eukaryotic SRCAP/p400/DOM and SNF2/brahma families [ (PUBMED:16024792) ]. While each family has the core sequences that define the HSA domain, they each also have additional sequences that distinguish these families from one another. For example, the sequence HWDY(L/C)EEEM(Q/V) is found in the SRCAP/p400/DOM family, whereas the sequence HQE(Y/F)LNSILQ is found in the SNF2 /brahma family [ (PUBMED:16024792) ]. In addition to the SANT and helicase domains, the HSA domain is also found in association with the bromo domain [ (PUBMED:11779830) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSA