The domain within your query sequence starts at position 9 and ends at position 62; the E-value for the HSBP1 domain shown below is 1.4e-27.

MQDITLVVETLLQQMQDKFQIMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE

HSBP1

HSBP1
PFAM accession number:PF06825
Interpro abstract (IPR009643):

Heat shock factor binding protein 1 (HSBP1) interacts with the oligomerization domain of heat shock factor 1 (Hsf1), suppressing Hsf1's transcriptional activity following stress. It plays an essential role during early mouse and zebrafish embryonic development [ (PUBMED:24380799) ]. In the plant Arabidopsis, heat shock factor-binding protein (HSBP) is required for acquired thermotolerance but not basal thermotolerance [ (PUBMED:20388662) ] and for seed development [ (PUBMED:20657173) ].

GO function:transcription corepressor activity (GO:0003714)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSBP1