The domain within your query sequence starts at position 31 and ends at position 379; the E-value for the HSD3 domain shown below is 2.1e-171.
NAAVDCSIPVSVNTSIKYADQQRREKLRKELARCEKEFKLSKSAMQTNSKMNSKFFVNSL QKPSGEPQDQDVFIEEMTRYPSFSKSLIPSSEGLHLSLPESSKMLMSGTQKHASTSPSRH SGCGHGCDRRPRSAHQFQVALAKTPSGDLLEKHSDLFSNKQSPFTPRTLKTEAKSFLSQY RYYTPAKRRKDFSDQRMEAETQTELSSFNSELGTAEKTSSKDSEVNINQVPNYTRNGAED KIAPLPSQGQNLAWDSIQDGILQQSSERASCKLSTEFSPDSKIYSDEEELLYLSFMENVT DEILKLGLFSNRFLERLFERHIKKNKHHLEEGKMRYLLHGLKVDLGCIS
HSD3 |
![]() |
---|
PFAM accession number: | PF15244 |
---|---|
Interpro abstract (IPR029357): | This entry represents the spermatogenesis-associated protein 7 (SPATA7, also known as HSD3). It was first identified in human spermatocytes. Later on, it was also found expressed in multiple layers of the mature mouse retina [ (PUBMED:19268277) ]. Mutations in SPATA7 cause Leber congenital amaurosis 3 (LCA3), which is a severe dystrophy of the retina, typically becoming evident in the first years of life [ (PUBMED:19268277) (PUBMED:20104588) ]. Mutations in SPATA7 also cause autosomal recessive retinitis pigmentosa (ARRP), which is a retinal dystrophy belonging to the group of pigmentary retinopathies [ (PUBMED:19268277) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSD3