The domain within your query sequence starts at position 326 and ends at position 425; the E-value for the HSNSD domain shown below is 8.2e-62.
VKALLDTQNLLRTQITNFTFNLGFSGKFYHTGTEEEDEGDDCLLGSVDEFWWFPHMWSHM QPHLFHNESSLIEQMILNKKFALEHGIPTDMGYAVSPHHS
HSNSD |
 |
|---|
| PFAM accession number: | PF12062 |
|---|---|
| Interpro abstract (IPR021930): | This domain is found in heparan sulphate N-deacetylase enzymes. It is often found associated with . |
| GO function: | hydrolase activity (GO:0016787), [heparan sulfate]-glucosamine N-sulfotransferase activity (GO:0015016) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HSNSD