The domain within your query sequence starts at position 7 and ends at position 68; the E-value for the HTH_9 domain shown below is 9.4e-26.
KLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHHNLVLYH VH
HTH_9 |
---|
PFAM accession number: | PF08221 |
---|---|
Interpro abstract (IPR013197): | DNA-directed RNA polymerases EC 2.7.7.6 (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme [ (PUBMED:3052291) ]. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length [ (PUBMED:10499798) ]. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3' direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:
Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700kDa, contain two non-identical large (>100kDa) subunits and an array of up to 12 different small (less than 50kDa) subunits. This family consists of several DNA-directed RNA polymerase III polypeptides which are related to the Saccharomyces cerevisiae (Baker's yeast) RPC82 protein. RNA polymerase C (III) promotes the transcription of tRNA and 5S RNA genes. In S. cerevisiae, the enzyme is composed of 15 subunits, ranging from 10kDa to about 160kDa [ (PUBMED:1406632) ]. This region is probably a DNA-binding helix-turn-helix. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HTH_9