The domain within your query sequence starts at position 23 and ends at position 184; the E-value for the Hat1_N domain shown below is 1.3e-49.

KCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLST
LFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKETNFKPFGTLLHT
YTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLMWFIE

Hat1_N

• PFAM accession number: PF10394
• Interpro abstract (IPR019467):

  This entry represents the N-terminal half of the structure of histone acetyl transferase HAT1. It is often found in association with the C-terminal part of IPR000182 . It seems to be motifs C and D of the structure. Histone acetyltransferases (HATs) catalyse the transfer of an acetyl group from acetyl-CoA to the lysine E-amino groups on the N-terminal tails of histones. HATs are involved in transcription since histones tend to be hyper-acetylated in actively transcribed regions of chromatin, whereas in transcriptionally silent regions histones are hypo-acetylated [ (PUBMED:9175471) ].

• GO process: chromatin organization (GO:0006325)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hat1_N