The domain within your query sequence starts at position 678 and ends at position 735; the E-value for the Helicase_C domain shown below is 6.4e-9.
HFGSHRYQILPLHSQIPREEQRKVFDPVPDGVTKVILSTNIAETSITINDVVYVIDSC
Helicase_C |
---|
PFAM accession number: | PF00271 |
---|---|
Interpro abstract (IPR001650): | Helicases have been classified in 5 superfamilies (SF1-SF5). For the two largest groups, commonly referred to as SF1 and SF2, a total of seven characteristic motifs has been identified [ (PUBMED:2546125) ]. These two superfamilies encompass a large number of DNA and RNA helicases from archaea, eubacteria, eukaryotes and viruses. This entry represents the C-terminal domain found in proteins belonging to the helicase superfamilies 1 and 2. Included in this group is the eukaryotic translation initiation factor 4A (eIF4A), a member of the DEA(D/H)-box RNA helicase family. The structure of the carboxyl-terminal domain of eIF4A has been determined; it has a parallel alpha-beta topology that superimposes, with minor variations, on the structures and conserved motifs of the equivalent domain in other, distantly related helicases [ (PUBMED:11087862) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_C