The domain within your query sequence starts at position 76 and ends at position 203; the E-value for the Helicase_C_3 domain shown below is 1.2e-46.
LWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSD ITEYLRKLSKTGVPDGIIQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIR ECRLRNAE
Helicase_C_3 |
---|
PFAM accession number: | PF13625 |
---|---|
Interpro abstract (IPR032830): | This domain is found in the N-terminal region of XPB/Ssl2. XPB/Ssl2 is a component of RNA polymerase transcription factor TFIIH holoenzyme required for DNA unwinding during transcription initiation [ (PUBMED:25775526) ]. It plays a dual role in transcription and DNA repair [ (PUBMED:25641424) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_C_3