SMART: Pfam domain Helicase

The domain within your query sequence starts at position 281 and ends at position 488; the E-value for the Helicase_RecD domain shown below is 1.3e-68.

ALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLD
YEIVQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKS
LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTL
HEVSLQESIRYAPGDAVEKWLNDLLCLD

Helicase_RecD

PFAM accession number:	PF05127
Interpro abstract (IPR007807):	This domain contains a P-loop (Walker A) motif, suggesting that it has ATPase activity, and a Walker B motif. In tRNA(Met) cytidine acetyltransferase (TmcA) it may function as an RNA helicase motor (driven by ATP hydrolysis) which delivers the wobble base to the active centre of the GCN5-related N-acetyltransferase (GNAT) domain [ (PUBMED:19322199) ]. It is found in the bacterial exodeoxyribonuclease V alpha chain (RecD), which has 5'-3' helicase activity. It is structurally similar to the motor domain 1A in other SF1 helicases [ (PUBMED:15538360) ].

PFAM accession number:

PF05127

Interpro abstract (IPR007807):

This domain contains a P-loop (Walker A) motif, suggesting that it has ATPase activity, and a Walker B motif. In tRNA(Met) cytidine acetyltransferase (TmcA) it may function as an RNA helicase motor (driven by ATP hydrolysis) which delivers the wobble base to the active centre of the GCN5-related N-acetyltransferase (GNAT) domain [ (PUBMED:19322199) ]. It is found in the bacterial exodeoxyribonuclease V alpha chain (RecD), which has 5'-3' helicase activity. It is structurally similar to the motor domain 1A in other SF1 helicases [ (PUBMED:15538360) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Helicase_RecD