The domain within your query sequence starts at position 56 and ends at position 168; the E-value for the HhH-GPD domain shown below is 2.7e-5.
IATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFS DEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWEN
HhH-GPD |
 |
|---|
| PFAM accession number: | PF00730 |
|---|---|
| Interpro abstract (IPR003265): | The HhH-GPD superfamily gets its name from its hallmark helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate [ (PUBMED:10706276) (PUBMED:8805338) ]. This domain is found in a diverse range of structurally related DNA repair proteins that include: endonuclease III, EC 4.2.99.18 and DNA glycosylase MutY, an A/G-specific adenine glycosylase. Both of these enzymes have a C-terminal iron-sulphur cluster loop (FCL). The methyl-CPG binding protein (MBD4) also contain a related domain that is a thymine DNA glycosylase [ (PUBMED:10499592) ]. The family also includes DNA-3-methyladenine glycosylase II EC 3.2.2.21 8-oxoguanine DNA glycosylases and other members of the AlkA family. |
| GO process: | base-excision repair (GO:0006284) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HhH-GPD