The domain within your query sequence starts at position 65 and ends at position 127; the E-value for the HlyIII domain shown below is 4.6e-12.
FQRHNEAVNVWTHLLAALALLLRLIGLAASVDFREDPHALPLFFIVLASFTYLSFSAVAH LLQ
HlyIII |
![]() |
---|
PFAM accession number: | PF03006 |
---|---|
Interpro abstract (IPR004254): | Members of this family are integral membrane proteins. This family includes a protein with hemolytic activity from Bacillus cereus [ (PUBMED:7495855) ]. YOL002c (AdipoR-like receptor IZH2) from Saccharomyces cerevisiae encodes a protein that plays a key role in metabolic pathways that regulate lipid and phosphate metabolism [ (PUBMED:11916977) (PUBMED:15664187) ]. In eukaryotes, members are seven-transmembrane pass molecules found to encode functional receptors with a broad range of apparent ligand specificities, including progestin and adiponectin (AdipoQ) receptors (AdipoR), and hence have been named PAQR proteins [ (PUBMED:16044242) ]. The mammalian members include progesterone binding proteins [ (PUBMED:17082257) ]. Unlike the case with GPCR receptor proteins, the evolutionary ancestry of the members of this family can be traced back to the Archaea. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HlyIII