The domain within your query sequence starts at position 257 and ends at position 292; the E-value for the HnRNPA1 domain shown below is 2.6e-17.

GGSYNDFGNYNNQSSNFGPMKGGIFGGRSSGPYGGG

HnRNPA1

HnRNPA1
PFAM accession number:PF11627
Interpro abstract (IPR021662):

This family of proteins represents hnRNPA1, a nuclear factor that binds to Pol II transcripts. The family of hnRNP proteins are involved in numerous RNA-related activities [ (PUBMED:15776420) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HnRNPA1