The domain within your query sequence starts at position 16 and ends at position 239; the E-value for the Hormone_1 domain shown below is 2.8e-56.
LVVSNLLLWEKAASNLPCVAEEGGCWNPLLETFNSATQKAETLHNLADQLYVELYYNQFS SGQFWDFSSQIIRQDKTVVRAGSYCHSSLTNPPNTGVHINIEIASYLKTLINFVGSWISP LFHLVIELSATKDVPETILSKAKEIEENNRQILSDLRWILTKVSPAAEMTEEFPHWEYLS FLKSSDKNNKFLAMFNLSYCIDHDSKYILLQLRLLKCLITGKDC
Hormone_1 |
---|
PFAM accession number: | PF00103 |
---|---|
Interpro abstract (IPR001400): | Somatotropin is a hormone that plays an important role in growth control. It belongs to a family that includes choriomammotropin (lactogen), its placental analogue; prolactin, which promotes lactation in the mammary gland, and placental prolactin-related proteins; proliferin and proliferin related protein; and somatolactin from various fish [ (PUBMED:2765528) (PUBMED:1993170) (PUBMED:2790033) ]. The 3D structure of bovine somatotropin has been predicted using a combination of heuristics and energy minimisation [ (PUBMED:2021631) ]. |
GO component: | extracellular region (GO:0005576) |
GO function: | hormone activity (GO:0005179) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hormone_1