The domain within your query sequence starts at position 1 and ends at position 126; the E-value for the Hox9_act domain shown below is 2e-47.
MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAATAEFASCSFAP KSSVFSASWSAVAAQPPAAATMSGLYHPYVSPPPLAAAEPGRYVRSWMEPLPGFPGGAGG GGGSGG
Hox9_act |
![]() |
---|
PFAM accession number: | PF04617 |
---|---|
Interpro abstract (IPR006711): | This domain constitutes the N-terminal of the paralogous homeobox proteins HoxA9, HoxB9, HoxC9 and HoxD9. The N-terminal region is thought to act as a transcription activation region. Activation may be by interaction with proteins such as Btg proteins, which are thought to recruit a multi-protein Ccr4-like complex [ (PUBMED:10617598) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hox9_act