The domain within your query sequence starts at position 136 and ends at position 219; the E-value for the HoxA13_N domain shown below is 6.2e-25.

PGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPA
SAAAAFADKYMDTAGPAAEEFSSR

HoxA13_N

HoxA13_N
PFAM accession number:PF12284
Interpro abstract (IPR022067):

This domain represents the N-terminal region of HoxA13 and other Hox proteins (HoxB13, HoxC13 and HoxD13). HoxA13 is involved in formation of the digital arch of the hands and feet, as well as in correct genital formation [ (PUBMED:10656931) ]. This domain is found in association with .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HoxA13_N