SMART: Pfam domain Hrs

The domain within your query sequence starts at position 405 and ends at position 500; the E-value for the Hrs_helical domain shown below is 2.2e-48.

EQFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRL
YYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE

Hrs_helical

PFAM accession number:	PF12210
Interpro abstract (IPR024641):	This domain comprises the helical region of hepatocyte growth factor-regulated tyrosine kinase substrate (HRS). It is approximately 100 amino acids in length. Hrs, together with signal transducing adaptor molecule (STAM), forms the ESCRT-0 complex, which sorts ubiquitinated cell surface receptors to lysosomes for degradation [ (PUBMED:19278655) ].

PFAM accession number:

PF12210

Interpro abstract (IPR024641):

This domain comprises the helical region of hepatocyte growth factor-regulated tyrosine kinase substrate (HRS). It is approximately 100 amino acids in length.

Hrs, together with signal transducing adaptor molecule (STAM), forms the ESCRT-0 complex, which sorts ubiquitinated cell surface receptors to lysosomes for degradation [ (PUBMED:19278655) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hrs_helical