The domain within your query sequence starts at position 406 and ends at position 500; the E-value for the Hrs_helical domain shown below is 1.2e-41.
QFLKALQNAVSTFVNRMKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLY YEGLQDKLAQIRDARGALSALREEHREKLRRAAEE
Hrs_helical |
---|
PFAM accession number: | PF12210 |
---|---|
Interpro abstract (IPR024641): | This domain comprises the helical region of hepatocyte growth factor-regulated tyrosine kinase substrate (HRS). It is approximately 100 amino acids in length. Hrs, together with signal transducing adaptor molecule (STAM), forms the ESCRT-0 complex, which sorts ubiquitinated cell surface receptors to lysosomes for degradation [ (PUBMED:19278655) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hrs_helical