The domain within your query sequence starts at position 9 and ends at position 53; the E-value for the Hydant_A_N domain shown below is 8.2e-14.
HFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRR
Hydant_A_N |
![]() |
---|
PFAM accession number: | PF05378 |
---|---|
Interpro abstract (IPR008040): | This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hydant_A_N