The domain within your query sequence starts at position 165 and ends at position 297; the E-value for the Hydrolase_4 domain shown below is 1.2e-16.

ASNHAIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDA
LHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKS
HPFSVIYRYFPGF

Hydrolase_4

• PFAM accession number: PF12146
• Interpro abstract (IPR022742):

  This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. The majority of the members in this entry carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in Q7ZWC2 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Hydrolase_4