The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the ICAP-1_inte_bdg domain shown below is 1.1e-45.

XLEEEFILGVSKYGIKVSTTDQHGVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASN
EEYSLWVYQCNSLVRDLGL

ICAP-1_inte_bdg

• PFAM accession number: PF10480
• Interpro abstract (IPR019517):

  ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin. The cytoplasmic domains of integrins are essential for cell adhesion, and the fact that phosphorylation of ICAP-1 by interaction with the cell-matrix implies an important role of ICAP-1 during integrin-dependent cell adhesion [ (PUBMED:9281591) ]. Over expression of ICAP-1 strongly reduces the integrin-mediated cell spreading on extracellular matrix and inhibits both Cdc42 and Rac1. In addition, ICAP-1 induces release of Cdc42 from cellular membranes and prevents the dissociation of GDP from this GTPase [ (PUBMED:11807099) ]. An additional function of ICAP-1 is to promote differentiation of osteoprogenitors by supporting their condensation through modulating the integrin high affinity state [ (PUBMED:17567669) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ICAP-1_inte_bdg