The domain within your query sequence starts at position 959 and ends at position 1066; the E-value for the IF-2 domain shown below is 1.4e-20.
LIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKAS VMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFT
IF-2 |
![]() |
---|
PFAM accession number: | PF11987 |
---|---|
Interpro abstract (IPR023115): | Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria [ (PUBMED:15755955) ]. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95kDa that contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this group undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation. The function of IF-2 in facilitating the proper binding of initiator methionyl-tRNA to the ribosomal P site appears to be universally conserved [ (PUBMED:10200264) ]. This entry represents the domain 3 of IF-2. It consists of a alpha/beta/alpha structure with a core formed by a parallel beta-sheet of 4 strands [ (PUBMED:11114334) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IF-2