The domain within your query sequence starts at position 50 and ends at position 212; the E-value for the IF4E domain shown below is 4.4e-64.

PLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFH
LFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVR
FQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTH

IF4E

IF4E
PFAM accession number:PF01652
Interpro abstract (IPR001040):

Eukaryotic translation initiation factor 4E (eIF-4E) [ (PUBMED:1733496) ] is a protein that binds to the cap structure of eukaryotic cellular mRNAs. eIF-4E recognises and binds the 7-methylguanosine-containing (m7Gppp) cap during an early step in the initiation of protein synthesis and facilitates ribosome binding to a mRNA by inducing the unwinding of its secondary structures. A tryptophan in the central part of the sequence of human eIF-4E seems to be implicated in cap-binding [ (PUBMED:1672854) ].

GO process:translational initiation (GO:0006413)
GO function:RNA binding (GO:0003723), translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry IF4E