The domain within your query sequence starts at position 55 and ends at position 217; the E-value for the IF4E domain shown below is 2.4e-64.
PLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFH LFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVR FQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTH
IF4E |
---|
PFAM accession number: | PF01652 |
---|---|
Interpro abstract (IPR001040): | Eukaryotic translation initiation factor 4E (eIF-4E) [ (PUBMED:1733496) ] is a protein that binds to the cap structure of eukaryotic cellular mRNAs. eIF-4E recognises and binds the 7-methylguanosine-containing (m7Gppp) cap during an early step in the initiation of protein synthesis and facilitates ribosome binding to a mRNA by inducing the unwinding of its secondary structures. A tryptophan in the central part of the sequence of human eIF-4E seems to be implicated in cap-binding [ (PUBMED:1672854) ]. |
GO process: | translational initiation (GO:0006413) |
GO function: | translation initiation factor activity (GO:0003743), RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IF4E