The domain within your query sequence starts at position 44 and ends at position 401; the E-value for the IFT57 domain shown below is 2.1e-154.
MEDLVEKLKLLRYEEELLRKSNLKPPSRHYFALPTNPGEQFYMFCTLAAWLINKTGRAFE QPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEQVCYVLDCLAEEALKYIGFTW KRPSYPVEELEEETVPEDDAELTLSKVDEEFVEEETDNEENFIDLNVLKAQTYRLDTNES AKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHKSGIESALKETK GFLDKLHNEISRTLEKIGSREKYINNQLEHLVQEYRGAQAQLSEARERYQQGNGGVTERT RLLSEVTEELEKVKQEMEEKGSSMTDGTPLVKIKQSLTKLKQETVQMDIRIGVVEHTL
IFT57 |
---|
PFAM accession number: | PF10498 |
---|---|
Interpro abstract (IPR019530): | Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bi-directional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated [ (PUBMED:15955805) ]. This protein is known as Huntington-interacting protein-1 in humans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IFT57