The domain within your query sequence starts at position 5 and ends at position 152; the E-value for the IHABP4_N domain shown below is 1e-38.
LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSN AAGKQLRKESQKDRKNPLPPSVGVADKKEETQPPVALKKEGIRRVGRRPDQQLQGDGKLI DRRAERRPPRERRFEKPLEEKGEGGEFS
IHABP4_N |
---|
PFAM accession number: | PF16174 |
---|---|
Interpro abstract (IPR032381): | This is the N-terminal region of intracellular hyaluronan-binding protein 4 and SERPINE1 mRNA-binding protein 1-like proteins. This region carries nuclear localisation sites, and may also be involved in the binding to some of the partners in the translational machinery [ (PUBMED:11001948) (PUBMED:12505151) (PUBMED:21771594) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry IHABP4_N